Recombinant Escherichia coli Acidic protein msyB (msyB) | CSB-BP340725ENV

Recombinant Escherichia coli Acidic protein msyB (msyB) | CSB-BP340725ENV | Cusabio

Alternative Name(s): msyB; b1051; JW1039; Acidic protein MsyB

Gene Names: msyB

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER

Source: Baculovirus

Tag Info: C-terminal 6xHis-tagged

Expression Region: 1-124aa

Sequence Info: Full Length

MW: 16.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Could participate in the normal pathway of protein export.

Reference: "Multicopy suppression: an approach to understanding intracellular functioning of the protein export system." Ueguchi C., Ito K. J. Bacteriol. 174:1454-1461(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Could participate in the normal pathway of protein export.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25738

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A