Recombinant Escherichia coli 8-oxo-dGTP diphosphatase (mutT) | CSB-YP357355ENV

(No reviews yet) Write a Review
SKU:
CSB-YP357355ENV
Availability:
25 - 35 Working Days
  • Recombinant Escherichia coli 8-oxo-dGTP diphosphatase (mutT)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $1,614.00

Description

Recombinant Escherichia coli 8-oxo-dGTP diphosphatase (mutT) | CSB-YP357355ENV | Cusabio

Alternative Name(s): 7,8-dihydro-8-oxoguanine-triphosphatase;Mutator protein MutTdGTP pyrophosphohydrolase

Gene Names: mutT

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-129aa

Sequence Info: Full Length

MW: 16.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the GO syst responsible for roving an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool. 8-oxo-dGTP is inserted opposite dA and dC residues of tplate DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT specifically degrades 8-oxo-dGTP to the monophosphate.

Reference: Characterization of the mutT nucleoside triphosphatase of Escherichia coli.Bhatnagar S.K., Bullions L.C., Bessman M.J.J. Biol. Chem. 266:9050-9054(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the GO system responsible for removing an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool. 8-oxo-dGTP is inserted opposite dA and dC residues of template DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT specifically degrades 8-oxo-dGTP to the monophosphate.

Involvement in disease:

Subcellular Location:

Protein Families: Nudix hydrolase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08337

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose