Recombinant Escherichia coli 50S ribosomal protein L31 (rpmE) | CSB-RP088444Ba

(No reviews yet) Write a Review
SKU:
CSB-RP088444Ba
Availability:
13 - 23 Working Days
  • Recombinant Escherichia coli 50S ribosomal protein L31 (rpmE)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Escherichia coli 50S ribosomal protein L31 (rpmE) | CSB-RP088444Ba | Cusabio

Alternative Name(s): rpmE; b3936; JW3907; 50S ribosomal protein L31; Large ribosomal subunit protein bL31-A

Gene Names: rpmE

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-70aa

Sequence Info: Full Length

MW: 34.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds the 23S rRNA.

Reference: Structures of the bacterial ribosome at 3.5 A resolution.Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds the 23S rRNA.

Involvement in disease:

Subcellular Location:

Protein Families: Bacterial ribosomal protein bL31 family, Type A subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0A7M9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose