Cusabio Escherichia coli Recombinants
Recombinant Escherichia coli 50S ribosomal protein L27 (rpmA) | CSB-EP358995ENVe0
- SKU:
- CSB-EP358995ENVe0
- Availability:
- 13 - 23 Working Days
Description
Recombinant Escherichia coli 50S ribosomal protein L27 (rpmA) | CSB-EP358995ENVe0 | Cusabio
Alternative Name(s): rpmA; b3185; JW3152; 50S ribosomal protein L27; Large ribosomal subunit protein bL27
Gene Names: rpmA
Research Areas: Others
Organism: Escherichia coli (strain K12)
AA Sequence: AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 2-85aa
Sequence Info: Full Length of Mature Protein
MW: 36 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry.Arnold R.J., Reilly J.P.Anal. Biochem. 269:105-112(1999)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families: Bacterial ribosomal protein bL27 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P0A7L8
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A