Recombinant Escherichia coli 30S ribosomal protein S18 (rpsR) | CSB-RP086844Ba

Recombinant Escherichia coli 30S ribosomal protein S18 (rpsR) | CSB-RP086844Ba | Cusabio

Alternative Name(s): rpsR; b4202; JW4160; 30S ribosomal protein S18; Small ribosomal subunit protein bS18

Gene Names: rpsR

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: ARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRHQ

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-75aa

Sequence Info: Full Length of Mature Protein

MW: 35.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit.

Reference: Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement.Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.Cell 113:789-801(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit.

Involvement in disease:

Subcellular Location:

Protein Families: Bacterial ribosomal protein bS18 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0A7T7

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A