Recombinant Escherichia coli 30S ribosomal protein S13 (rpsM) | CSB-RP087344Ba

Recombinant Escherichia coli 30S ribosomal protein S13 (rpsM) | CSB-RP087344Ba | Cusabio

Alternative Name(s): rpsM; b3298; JW3260; 30S ribosomal protein S13; Small ribosomal subunit protein uS13

Gene Names: rpsM

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-118aa

Sequence Info: Full Length of Mature Protein

MW: 40 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.

Reference: Identification of a cross-link in the Escherichia coli ribosomal protein pair S13-S19 at the amino acid level.Pohl T., Wittmann-Liebold B.J. Biol. Chem. 263:4293-4301(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.

Involvement in disease:

Subcellular Location:

Protein Families: Universal ribosomal protein uS13 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0A7S9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A