Recombinant Escherichia coli 30S ribosomal protein S10 (rpsJ) | CSB-RP087644Ba

Recombinant Escherichia coli 30S ribosomal protein S10 (rpsJ) | CSB-RP087644Ba | Cusabio

Alternative Name(s): rpsJ; nusE; b3321; JW3283; 30S ribosomal protein S10; Small ribosomal subunit protein uS10

Gene Names: rpsJ

Research Areas: Others

Organism: Escherichia coli (strain K12)

AA Sequence: MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-103aa

Sequence Info: Full Length

MW: 38.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the binding of tRNA to the ribosomes.

Reference: All-atom homology model of the Escherichia coli 30S ribosomal subunit.Tung C.-S., Joseph S., Sanbonmatsu K.Y.Nat. Struct. Biol. 9:750-755(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the binding of tRNA to the ribosomes

Involvement in disease:

Subcellular Location:

Protein Families: Universal ribosomal protein uS10 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0A7R5

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A