Cusabio Epstein-Barr virus Recombinants
Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1) | CSB-EP365869EFA
- SKU:
- CSB-EP365869EFA
- Availability:
- 3 - 7 Working Days
Description
Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1) | CSB-EP365869EFA | Cusabio
Alternative Name(s): 20 kDa protein (Protein BCRF1) (vIL-10)
Gene Names: BCRF1
Research Areas: Others
Organism: Epstein-Barr virus(strain B95-8)(HHV-4)(Human herpesvirus 4)
AA Sequence: TDQCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 24-170aa
Sequence Info: Full Length of Mature Protein
MW: 24.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Plays a role in masking infected cells for immune recognition by cytotoxic T-lymphocytes. Down-regulates the expression of the host TAP1 gene, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules. Inhibits IFN-gamma synthesis.
Reference: "Homology of cytokine synthesis inhibitory factor (IL-10) to the Epstein-Barr virus gene BCRFI." Moore K.W., Vieira P., Fiorentino D.F., Trounstine M.L., Khan T.A., Mosmann T.R. Science 248:1230-1234(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P03180
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A