Recombinant Enterovirus A71 Genome polyprotein, partial | CSB-EP3114GLAa2

(No reviews yet) Write a Review
SKU:
CSB-EP3114GLAa2
Availability:
3 - 7 Working Days
$422.40 - $2,042.40

Description

Recombinant Enterovirus A71 Genome polyprotein, partial | CSB-EP3114GLAa2 | Cusabio

Alternative Name(s): VP4-VP2 (P1A) (Virion protein 4) (Capsid protein VP2) (P1B) (Virion protein 2) (P1C) (Virion protein 3) (P1D) (Virion protein 1) (Picornain 2A) (Protein 2A) (Protein 3B) (P3B) (3D polymerase) (3Dpol) (Protein 3D)

Gene Names: N/A

Research Areas: Others

Organism: Enterovirus A71

AA Sequence: GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1441-1497aa

Sequence Info: Partial

MW: 19.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Capsid protein VP0: Component of immature procapsids, which is cleaved into capsid proteins VP4 and VP2 after maturation. Allows the capsid to remain inactive before the maturation step.

Reference: "Enterovirus 71 and coxsackievirus A16 3C proteases: binding to rupintrivir and their substrates and anti-hand, foot, and mouth disease virus drug design." Lu G., Qi J., Chen Z., Xu X., Gao F., Lin D., Qian W., Liu H., Jiang H., Yan J., Gao G.F. J. Virol. 85:10319-10331(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: F6KTB0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose