Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5?2.5? | CSB-EP366021EEB

(No reviews yet) Write a Review
SKU:
CSB-EP366021EEB
Availability:
3 - 7 Working Days
  • Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5?2.5?
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5?2.5? | CSB-EP366021EEB | Cusabio

Alternative Name(s): Single-stranded DNA-binding protein ;SSB protein

Gene Names: 2.5

Research Areas: Others

Organism: Enterobacteria phage T3 (Bacteriophage T3)

AA Sequence: MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-232aa

Sequence Info: Full Length

MW: 41.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Helix-destabilizing protein, which is expressed in the late stage of lytic development, binds preferentially to single-stranded DNA. It is implicated in DNA replication, recombination, and repair.

Reference: Sequence of bacteriophage T3 DNA from gene 2.5 through gene 9.Beck P.J., Gonzalez S., Ward C.L., Molineux I.J.J. Mol. Biol. 210:687-701(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P03696

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose