Cusabio Virus & Bacteria Recombinants
Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) | CSB-YP300809EKZ
- SKU:
- CSB-YP300809EKZ
- Availability:
- 25 - 35 Working Days
Description
Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) | CSB-YP300809EKZ | Cusabio
Alternative Name(s): Verocytotoxin 1 subunit B ;Verotoxin 1 subunit B
Gene Names: stxB
Research Areas: Others
Organism: Enterobacteria phage H19B (Bacteriophage H19B)
AA Sequence: TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 21-89aa
Sequence Info: Full Length of Mature Protein
MW: 9.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Reference: Nucleotide sequence of the Shiga-like toxin genes of Escherichia coli.Calderwood S.B., Auclair F., Donohue-Rolfe A., Keusch G.T., Mekalanos J.J.Proc. Natl. Acad. Sci. U.S.A. 84:4364-4368(1987)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: StxB family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P69179
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A