Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) | CSB-EP300809EKZ

(No reviews yet) Write a Review
SKU:
CSB-EP300809EKZ
Availability:
13 - 23 Working Days
  • Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) | CSB-EP300809EKZ | Cusabio

Alternative Name(s): Verocytotoxin 1 subunit B ;Verotoxin 1 subunit B

Gene Names: stxB

Research Areas: Others

Organism: Enterobacteria phage H19B (Bacteriophage H19B)

AA Sequence: TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-89aa

Sequence Info: Full Length of Mature Protein

MW: 23.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Reference: Shiga-like toxins are neutralized by tailored multivalent carbohydrate ligands.Kitov P.I., Sadowska J.M., Mulvey G., Armstrong G.D., Ling H., Pannu N.S., Read R.J., Bundle D.R.Nature 403:669-672(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: StxB family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P69179

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose