Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2) | CSB-EP357663ECC

(No reviews yet) Write a Review
SKU:
CSB-EP357663ECC
Availability:
3 - 7 Working Days
  • Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2) | CSB-EP357663ECC | Cusabio

Alternative Name(s): Verocytotoxin 2 subunit B ;Verotoxin 2 subunit B

Gene Names: stxB2

Research Areas: Others

Organism: Enterobacteria phage 933W (Bacteriophage 933W)

AA Sequence: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-89aa

Sequence Info: Full Length of Mature Protein

MW: 23.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Reference: Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7.Fraser M.E., Cherney M.M., Marcato P., Mulvey G.L., Armstrong G.D., James M.N.Acta Crystallogr. F 62:627-630(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: StxB family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P09386

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose