Recombinant Enterobacter agglomerans Ice nucleation protein (iceE), partial | CSB-YP321430EKP

Recombinant Enterobacter agglomerans Ice nucleation protein (iceE), partial | CSB-YP321430EKP | Cusabio

Alternative Name(s): Ice nucleation protein

Gene Names: iceE

Research Areas: Others

Organism: Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans)

AA Sequence: MAGERGKLIAGADSTQTAGDRSKLLAGNNSYLTAGDRSKLTAGNDCILMAGDRSKLTAGINSILTAGCRSKLIGSNGSTLTAGENSVLIFRCWDGKRYTNVVAKTGKGGIEADMPYQMDEDNNIVNKPEE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1129-1258aa

Sequence Info: Partial

MW: 15.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ice nucleation proteins enable bacteria to nucleate crystallization in supercooled water.

Reference: "Isolation and characterization of hydroxylamine-induced mutations in the Erwinia herbicola ice nucleation gene that selectively reduce warm temperature ice nucleation activity." Gurian-Sherman D., Lindow S.E., Panopoulos N.J. Mol. Microbiol. 9:383-391(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16239

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A