Recombinant Drosophila melanogaster cAMP-dependent protein kinase catalytic subunit (Pka-C1) | CSB-EP318954DLU

(No reviews yet) Write a Review
SKU:
CSB-EP318954DLU
Availability:
13 - 23 Working Days
  • Recombinant Drosophila melanogaster cAMP-dependent protein kinase catalytic subunit (Pka-C1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Drosophila melanogaster cAMP-dependent protein kinase catalytic subunit (Pka-C1) | CSB-EP318954DLU | Cusabio

Alternative Name(s): Short name: PKA C

Gene Names: Pka-C1

Research Areas: Others

Organism: Drosophila melanogaster (Fruit fly)

AA Sequence: GNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-353aa

Sequence Info: Full Length of Mature Protein

MW: 56.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: ATP + a protein = ADP + a phosphoprotein.

Reference: "Cloning, sequence, and expression of the Drosophila cAMP-dependent protein kinase catalytic subunit gene."Foster J.L., Higgins G.C., Jackson R.F.J. Biol. Chem. 263:1676-1681(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: Protein kinase superfamily, AGC Ser/Thr protein kinase family, cAMP subfamily

Tissue Specificity: More abundant in adult head than adult body.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P12370

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose