Recombinant Drosophila melanogaster 40S ribosomal protein S3 (RpS3) | CSB-EP020443DLU

(No reviews yet) Write a Review
SKU:
CSB-EP020443DLU
Availability:
13 - 23 Working Days
  • Recombinant Drosophila melanogaster 40S ribosomal protein S3 (RpS3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Drosophila melanogaster 40S ribosomal protein S3 (RpS3) | CSB-EP020443DLU | Cusabio

Alternative Name(s): M(3)95A

Gene Names: RpS3

Research Areas: Others

Organism: Drosophila melanogaster (Fruit fly)

AA Sequence: MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-246aa

Sequence Info: Full Length

MW: 31.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta,delta elimination reaction.

Reference: "A Drosophila ribosomal protein contains 8-oxoguanine and abasic site DNA repair activities." Yacoub A., Augeri L., Kelley M.R., Doetsch P.W., Deutsch W.A. EMBO J. 15:2306-2312(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta,delta elimination reaction.

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus

Protein Families: Universal ribosomal protein uS3 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q06559

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose