Recombinant Dog Tight junction protein ZO-1 (TJP1), partial | CSB-EP023573DO

Recombinant Dog Tight junction protein ZO-1 (TJP1), partial | CSB-EP023573DO | Cusabio

Alternative Name(s): Tight junction protein 1Zona occludens protein 1Zonula occludens protein 1

Gene Names: TJP1

Research Areas: Others

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1633-1769aa

Sequence Info: Partial

MW: 18.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The N-terminal may be involved in transducing a signal required for tight junction assbly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells .

Reference: The heat-shock protein Apg-2 binds to the tight junction protein ZO-1 and regulates transcriptional activity of ZONAB.Tsapara A., Matter K., Balda M.S.Mol. Biol. Cell 17:1322-1330(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: TJP1, TJP2, and TJP3 are closely related scaffolding proteins that link tight junction (TJ) transmembrane proteins such as claudins, junctional adhesion molecules, and occludin to the actin cytoskeleton

Involvement in disease:

Subcellular Location: Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell junction, tight junction, Cell junction, Cell junction, gap junction

Protein Families: MAGUK family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O97758

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A