Recombinant Dog Glycoprotein hormones alpha chain (CGA) | CSB-EP895474DO

Recombinant Dog Glycoprotein hormones alpha chain (CGA) | CSB-EP895474DO | Cusabio

Alternative Name(s): Anterior pituitary glycoprotein hormones common subunit alpha;Follicle-stimulating hormone alpha chain;FSH-alpha;Follitropin alpha chain;Luteinizing hormone alpha chain;LSH-alpha;Lutropin alpha chain;Thyroid-stimulating hormone alpha chain;TSH-alpha;Thyrotropin alpha chain

Gene Names: CGA

Research Areas: others

Organism: Canis familiaris (Dog) (Canis lupus familiaris)

AA Sequence: FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 25-120aa

Sequence Info: Full Length of Mature Protein

MW: 18.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.

Reference: "cDNA cloning of canine common alpha gene and its co-expression with canine thyrotropin beta gene in baculovirus expression system." Yang X., McGraw R.A., Ferguson D.C. Domest. Anim. Endocrinol. 18:379-393(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9XSW8

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A