Recombinant Dog Cholinesterase (BCHE) | CSB-EP002604DO

Recombinant Dog Cholinesterase (BCHE) | CSB-EP002604DO | Cusabio

Alternative Name(s): Acylcholine acylhydrolase;Butyrylcholine esterase;Choline esterase II;Pseudocholinesterase

Gene Names: BCHE

Research Areas: Others

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: NTDQSFPGFPGSEMWNPNTDLSEDCLYLNVWIPTPKPKNATVMIWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSVNYRVGALGFLALPGNPEAPGNLGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAGSVGLHL

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-141aa

Sequence Info: Full Length

MW: 19.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters .

Reference: Use of the polymerase chain reaction for homology probing of butyrylcholinesterase from several vertebrates.Arpagaus M., Chatonnet A., Masson P., Newton M., Vaughan T.A., Bartels C.F., Nogueira C.P., la Du B.N., Lockridge O.J. Biol. Chem. 266:6966-6974(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Type-B carboxylesterase/lipase family

Tissue Specificity: Present in most cells except erythrocytes.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P32750

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A