Recombinant Dog Calcitonin (CALCA), partial | CSB-EP004434DO

(No reviews yet) Write a Review
SKU:
CSB-EP004434DO
Availability:
13 - 23 Working Days
  • Recombinant Dog Calcitonin (CALCA), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Dog Calcitonin (CALCA), partial | CSB-EP004434DO | Cusabio

Alternative Name(s): CALCA; CALC; CCALCI; Calcitonin

Gene Names: CALCA

Research Areas: Cardiovascular

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 85-116aa

Sequence Info: Partial

MW: 19.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.

Reference: "Molecular analysis and chromosomal assignment of the canine CALC-I/alpha-CGRP gene."Wende S., Krempler A., Breen M., Brunnberg L., Brenig B.Mamm. Genome 11:736-740(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Calcitonin family

Tissue Specificity: Synthesized by C-cells of the thyroid gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P41547

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose