Recombinant Dog C-C motif chemokine 17 (CCL17) | CSB-EP856825DO

(No reviews yet) Write a Review
SKU:
CSB-EP856825DO
Availability:
3 - 7 Working Days
  • Recombinant Dog C-C motif chemokine 17 (CCL17)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Dog C-C motif chemokine 17 (CCL17) | CSB-EP856825DO | Cusabio

Alternative Name(s): CC chemokine TARC;Small-inducible cytokine A17;Thymus and activation-regulated chemokine

Gene Names: CCL17

Research Areas: Immunology

Organism: Canis familiaris (Dog) (Canis lupus familiaris)

AA Sequence: ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES

Source: E.coli

Tag Info: N-terminal 6xHis-KSI-tagged

Expression Region: 24-99aa

Sequence Info: Full Length of Mature Protein

MW: 23.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Chemotactic factor for t lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8 (By similarity).

Reference: "Molecular cloning of canine thymus and activation-regulated chemokine (TARC) gene and its expression in various tissues." Maeda S., Mizuno T., Yamashita K., Kurata K., Masuda K., Ohno K., Tsujimoto H. J. Vet. Med. Sci. 63:1035-1038(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q95N01

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose