Cusabio Virus & Bacteria Recombinants
Recombinant Dendroaspis polylepis polylepis Toxin MIT1 | CSB-EP326235DBI
- SKU:
- CSB-EP326235DBI
- Availability:
- 13 - 23 Working Days
Description
Recombinant Dendroaspis polylepis polylepis Toxin MIT1 | CSB-EP326235DBI | Cusabio
Alternative Name(s): Short name: MIT 1 Alternative name(s): Black mamba intestinal toxin 1 Black mamba venom protein A
Gene Names: N/A
Research Areas: Others
Organism: Dendroaspis polylepis polylepis (Black mamba)
AA Sequence: AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-81aa
Sequence Info: Full Length
MW: 24.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel.
Reference: "MIT1, a black mamba toxin with a new and highly potent activity on intestinal contraction."Schweitz H., Pascaud P., Diochot S., Moinier D., Lazdunski M.FEBS Lett. 461:183-188(1999)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2
Involvement in disease:
Subcellular Location: Secreted
Protein Families: AVIT (prokineticin) family
Tissue Specificity: Expressed by the venom gland.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P25687
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A