Recombinant Dendroaspis polylepis polylepis Toxin MIT1 | CSB-EP326235DBI

(No reviews yet) Write a Review
SKU:
CSB-EP326235DBI
Availability:
13 - 23 Working Days
  • Recombinant Dendroaspis polylepis polylepis Toxin MIT1
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Dendroaspis polylepis polylepis Toxin MIT1 | CSB-EP326235DBI | Cusabio

Alternative Name(s): Short name: MIT 1 Alternative name(s): Black mamba intestinal toxin 1 Black mamba venom protein A

Gene Names: N/A

Research Areas: Others

Organism: Dendroaspis polylepis polylepis (Black mamba)

AA Sequence: AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-81aa

Sequence Info: Full Length

MW: 24.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel.

Reference: "MIT1, a black mamba toxin with a new and highly potent activity on intestinal contraction."Schweitz H., Pascaud P., Diochot S., Moinier D., Lazdunski M.FEBS Lett. 461:183-188(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2

Involvement in disease:

Subcellular Location: Secreted

Protein Families: AVIT (prokineticin) family

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25687

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose