Cusabio Danio rerio Recombinants
Recombinant Danio rerio Family with sequence similarity 19 (chemokine (C-C motif) -like), member A5a (fam19a5a), partial | CSB-EP2851DIL
- SKU:
- CSB-EP2851DIL
- Availability:
- 3 - 7 Working Days
Description
Recombinant Danio rerio Family with sequence similarity 19 (chemokine (C-C motif) -like), member A5a (fam19a5a), partial | CSB-EP2851DIL | Cusabio
Alternative Name(s): dkey-200m9.1
Gene Names: fam19a5a
Research Areas: Others
Organism: Danio rerio (Zebrafish) (Brachydanio rerio)
AA Sequence: TCEIVTLDKDSSQPRRTIARQTARCACKKGQIAGTTNARPACVDARIVKTKQWCDMVPCLEDEECDLLVNKSGWTCTQPSGRVKTTTVS
Source: E.coli
Tag Info: N-terminal 10xHis-tagged
Expression Region: 43-131aa
Sequence Info: Partial
MW: 15.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "The zebrafish reference genome sequence and its relationship to the human genome." Howe K., Clark M.D., Torroja C.F., Torrance J., Berthelot C., Muffato M., Collins J.E., Humphray S., McLaren K., Matthews L., McLaren S., Sealy I., Caccamo M., Churcher C., Scott C., Barrett J.C., Koch R., Rauch G.J. Stemple D.L. Nature 496:498-503(2013)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: A2BIC8
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A