Recombinant Danio rerio Erythropoietin (epo) | CSB-EP007743DIL

Recombinant Danio rerio Erythropoietin (epo) | CSB-EP007743DIL | Cusabio

Alternative Name(s): Erythropoietin-L2

Gene Names: epo

Research Areas: Cardiovascular

Organism: Danio rerio(Zebrafish)(Brachydanio rerio)

AA Sequence: SPLRPICDLRVLDHFIKEAWDAEAAMRTCKDDCSIATNVTVPLTRVDFEVWEAMNIEEQAQEVQSGLHMLNEAIGSLQISNQTEVLQSHIDASIRNIASIRQVLRSLSIPEYVPPTSSGEDKETQKISSISELFQVHVNFLRGKARLLLANAPVCRQGVS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 24-183aa

Sequence Info: Full Length of Mature Protein

MW: 21.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.

Reference: "Endurance exercise differentially stimulates heart and axial muscle development in zebrafish (Danio rerio)." van der Meulen T., Schipper H., van den Boogaart J.G., Huising M.O., Kranenbarg S., van Leeuwen J.L. Am. J. Physiol. Regul. Integr. Comp. Physiol. 291:R1040-8(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q2XNF5

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A