Recombinant Cynops pyrrhogaster Annexin A5 | CSB-YP001846EQC

Recombinant Cynops pyrrhogaster Annexin A5 | CSB-YP001846EQC | Cusabio

Alternative Name(s): Annexin A5; Annexin V; Annexin-5

Gene Names: N/A

Research Areas: Others

Organism: Cynops pyrrhogaster (Japanese fire-bellied newt)

AA Sequence: MACLKGAKGTVQDAPDFNDKEDAETLRHAMKGLGTDEDTILKLLISRSNKQRQQIALTYKTLFGRDLTDDLKSELSGKFETLLVALMVPAHLYDACELRNAIKGLGTLENVIIEIMASRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFERLLVSLVQANRDPVGKVDEGQVENDAKALFDAGENKWGTDEETFISILSTRGVGHLRKVFDQYMTISGYQIEESIQSETGGHFEKLLLAVVKSIRSIQGYLAE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-323aa

Sequence Info: Full Length

MW: 30.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Calcium/phospholipid-binding protein which promotes mbrane fusion and is involved in exocytosis.

Reference: Differential expression of annexin V during spermatogenesis in the newt Cynops pyrrhogaster.Yamamoto T., Hikono T., Abe S.Dev. Genes Evol. 206:64-71(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

Involvement in disease:

Subcellular Location:

Protein Families: Annexin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P70075

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A