Recombinant Culex quinquefasciatus Submitted name: Odorant binding protein OBP28 (6050687) | CSB-BP3143DZM

(No reviews yet) Write a Review
SKU:
CSB-BP3143DZM
Availability:
3 - 7 Working Days
$531.60 - $1,766.40

Description

Recombinant Culex quinquefasciatus Submitted name: Odorant binding protein OBP28 (6050687) | CSB-BP3143DZM | Cusabio

Alternative Name(s): /

Gene Names: 6050687

Research Areas: Others

Organism: Culex quinquefasciatus (Southern house mosquito) (Culex pungens)

AA Sequence: DEASDKEQAKEQAKQMLRSMTQKCKEAEGASDDDVEAMIDDVMPESQVQKCFHSCVQQQFGVSDGQKFLQQGFLEIMMMAVGNDEQQQGHAKEVAEECDGVANEDRCQLAVDIMTCVKQGMEKRGMKVDR

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 21-150aa

Sequence Info: Full Length of Mature Protein

MW: 18.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Annotation of Culex pipiens quinquefasciatus." The Broad Institute Genome Sequencing Platform Atkinson P.W., Hemingway J., Christensen B.M., Higgs S., Kodira C.D., Hannick L.I., Megy K., O'Leary S.B., Pearson M., Haas B.J., Mauceli E., Wortman J.R., Lee N.H., Guigo R., Stanke M., Alvarado L., Amedeo P., Antoine C.H. Collins F.H. Submitted (MAR-2007) to the EMBL/GenBank/DDBJ databases

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: B0XC79

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose