Recombinant Cryptomeria japonica Sugi basic protein | CSB-YP322455DYO

Recombinant Cryptomeria japonica Sugi basic protein | CSB-YP322455DYO | Cusabio

Alternative Name(s): Pectate lyase 1; EC 4.2.2.2; Allergen Cry j I; Major allergen Cry j 1; Sugi basic protein; SBP; allergen Cry j 1

Gene Names: N/A

Research Areas: Others

Organism: Cryptomeria japonica (Japanese cedar) (Cupressus japonica)

AA Sequence: DNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHGLHLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVTLSSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-374aa

Sequence Info: Full Length of Mature Protein

MW: 40.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has pectate lyase activity.

Reference: Cloning and sequencing of cDNA coding for Cry j I, a major allergen of Japanese cedar pollen.Sone T., Komiyama N., Shimizu K., Kusakabe T., Morikubo K., Kino K.Biochem. Biophys. Res. Commun. 199:619-625(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has pectate lyase activity.

Involvement in disease:

Subcellular Location:

Protein Families: Polysaccharide lyase 1 family, Amb a subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P18632

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A