Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2 | CSB-EP330325DYB

Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2 | CSB-EP330325DYB | Cusabio

Alternative Name(s): Adamalysin II Proteinase II

Gene Names: N/A

Research Areas: Others

Organism: Crotalus adamanteus (Eastern diamondback rattlesnake)

AA Sequence: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-203aa

Sequence Info: Full Length

MW: 27.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops.

Reference: "First structure of a snake venom metalloproteinase: a prototype for matrix metalloproteinases/collagenases." Gomis-Rueth F.-X., Kress L.F., Bode W. EMBO J. 12:4151-4157(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Venom metalloproteinase (M12B) family, P-I subfamily

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P34179

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A