Recombinant Coxiella burnetii Protein RnfH (rnfH) | CSB-EP481560DXM

(No reviews yet) Write a Review
SKU:
CSB-EP481560DXM
Availability:
13 - 23 Working Days
  • Recombinant Coxiella burnetii Protein RnfH (rnfH)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Coxiella burnetii Protein RnfH (rnfH) | CSB-EP481560DXM | Cusabio

Alternative Name(s): rnfH; CbuG_0706; Protein RnfH

Gene Names: rnfH

Research Areas: Epigenetics and Nuclear Signaling

Organism: Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212))

AA Sequence: MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-101aa

Sequence Info: Full Length

MW: 27.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Comparative genomics reveal extensive transposon-mediated genomic plasticity and diversity among potential effector proteins within the genus Coxiella."Beare P.A., Unsworth N., Andoh M., Voth D.E., Omsland A., Gilk S.D., Williams K.P., Sobral B.W., Kupko J.J. III, Porcella S.F., Samuel J.E., Heinzen R.A.Infect. Immun. 77:642-656(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: UPF0125 (RnfH) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: B6IZH9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose