Recombinant Conus striatus Con-ikot-ikot | CSB-YP316701DWI

(No reviews yet) Write a Review
SKU:
CSB-YP316701DWI
Availability:
25 - 35 Working Days
  • Recombinant Conus striatus Con-ikot-ikot
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £1,076.00

Description

Recombinant Conus striatus Con-ikot-ikot | CSB-YP316701DWI | Cusabio

Alternative Name(s): Con-ikot-ikot

Gene Names: N/A

Research Areas: Others

Organism: Conus striatus (Striated cone)

AA Sequence: SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 38-123aa

Sequence Info: Full Length of Mature Protein

MW: 11.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Potently and selectively blocks the desensitization of ionotropic glutamate AMPA receptor (GRIA1, GRIA2, GRIA3 and GRIA4). Can also open already desensitized GRIA1 receptors. Binds to a different site than does the drug cyclothiazide . The toxin acts like a straightjacket on the ligand-binding domain (LBD) "gating ring" of the receptor, restraining the domains via both intra- and interdimer cross-links such that agonist-induced closure of the LBD "clamshells" is transduced into an irislike expansion of the gating ring . Application of the toxin to hippocampal slices causes a large and rapid increase in resting AMPAR-mediated current leading to neuronal death .

Reference: A novel Conus snail polypeptide causes excitotoxicity by blocking desensitization of AMPA receptors.Walker C.S., Jensen S., Ellison M., Matta J.A., Lee W.Y., Imperial J.S., Duclos N., Brockie P.J., Madsen D.M., Isaac J.T., Olivera B., Maricq A.V.Curr. Biol. 19:900-908(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Potently and selectively blocks the desensitization of ionotropic glutamate AMPA receptor (GRIA1, GRIA2, GRIA3 and GRIA4). Can also open already desensitized GRIA1 receptors. Binds to a different site than does the drug cyclothiazide

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Expressed by the venom duct.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0CB20

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose