Recombinant Chironex fleckeri Toxin CfTx-1, partial | CSB-EP417651CWM1

(No reviews yet) Write a Review
SKU:
CSB-EP417651CWM1
Availability:
13 - 23 Working Days
  • Recombinant Chironex fleckeri Toxin CfTx-1, partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Chironex fleckeri Toxin CfTx-1, partial | CSB-EP417651CWM1 | Cusabio

Alternative Name(s): Toxin CfTX-1; Toxin 1

Gene Names: N/A

Research Areas: Others

Organism: Chironex fleckeri (Box jellyfish)

AA Sequence: EQSDQELQEALYGVKREYAVSKAFLDGVRNETSDLSPTEVSALAANVPIYQGVRFIAMVVQRIKYIKPKTESEIKRMLTMLELFTDLCSLRDLILLDLYQLVATPGHSPNIASGIKEVSNLGREEYKKVFEDLLKNDDKETYLFLSYLYPREKNEQSRKIFNFFDLMKVKYDDRLKQDLTGVKIFSNVHWPNYFMCSSNDYLALICTKPYGSLKLDKLNDGYYSIKTTQHDPKICHRYGNYILFTHKRNDDLEKFNFVPVKLEKREIYLLSSKESPNKFAYVPQNADGALFFVDGIPSKVGYGNQGYFTLVE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 145-456aa

Sequence Info: Partial

MW: 52.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Has potent hemolytic activity. Is lethal to crayfish. Causes cutaneous inflammation in humans. May act as a pore-forming toxin, disrupting normal transmembrane ion concentration gradients in susceptible cells

Reference: "Identification, cloning and sequencing of two major venom proteins from the box jellyfish, Chironex fleckeri." Brinkman D., Burnell J. Toxicon 50:850-860(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has potent hemolytic activity. Is lethal to crayfish. Causes cutaneous inflammation in humans. May act as a pore-forming toxin, disrupting normal transmembrane ion concentration gradients in susceptible cells (By similarity).

Involvement in disease:

Subcellular Location: Secreted, Nematocyst, Target cell membrane

Protein Families: Jellyfish toxin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A7L035

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose