Cusabio Virus & Bacteria Recombinants
Recombinant Chironex fleckeri Toxin CfTx-1, partial | CSB-EP417651CWM1
- SKU:
- CSB-EP417651CWM1
- Availability:
- 13 - 23 Working Days
Description
Recombinant Chironex fleckeri Toxin CfTx-1, partial | CSB-EP417651CWM1 | Cusabio
Alternative Name(s): Toxin CfTX-1; Toxin 1
Gene Names: N/A
Research Areas: Others
Organism: Chironex fleckeri (Box jellyfish)
AA Sequence: EQSDQELQEALYGVKREYAVSKAFLDGVRNETSDLSPTEVSALAANVPIYQGVRFIAMVVQRIKYIKPKTESEIKRMLTMLELFTDLCSLRDLILLDLYQLVATPGHSPNIASGIKEVSNLGREEYKKVFEDLLKNDDKETYLFLSYLYPREKNEQSRKIFNFFDLMKVKYDDRLKQDLTGVKIFSNVHWPNYFMCSSNDYLALICTKPYGSLKLDKLNDGYYSIKTTQHDPKICHRYGNYILFTHKRNDDLEKFNFVPVKLEKREIYLLSSKESPNKFAYVPQNADGALFFVDGIPSKVGYGNQGYFTLVE
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 145-456aa
Sequence Info: Partial
MW: 52.2 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Has potent hemolytic activity. Is lethal to crayfish. Causes cutaneous inflammation in humans. May act as a pore-forming toxin, disrupting normal transmembrane ion concentration gradients in susceptible cells
Reference: "Identification, cloning and sequencing of two major venom proteins from the box jellyfish, Chironex fleckeri." Brinkman D., Burnell J. Toxicon 50:850-860(2007)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Has potent hemolytic activity. Is lethal to crayfish. Causes cutaneous inflammation in humans. May act as a pore-forming toxin, disrupting normal transmembrane ion concentration gradients in susceptible cells (By similarity).
Involvement in disease:
Subcellular Location: Secreted, Nematocyst, Target cell membrane
Protein Families: Jellyfish toxin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: A7L035
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A