Recombinant Chikungunya virus Non-structural protein 4 (nsP4), partial | CSB-EP810351CJAT

(No reviews yet) Write a Review
SKU:
CSB-EP810351CJAT
Availability:
3 - 7 Working Days
  • Recombinant Chikungunya virus Non-structural protein 4 (nsP4), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Chikungunya virus Non-structural protein 4 (nsP4), partial | CSB-EP810351CJAT | Cusabio

Alternative Name(s): Polyprotein nsP1234

Gene Names: nsp4

Research Areas: Others

Organism: Chikungunya virus (strain S27-African prototype) (CHIKV)

AA Sequence: DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2228-2474aa

Sequence Info: Partial

MW: 31.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Complete nucleotide sequence of chikungunya virus and evidence for an internal polyadenylation site."Khan A.H., Morita K., Parquet Md Mdel C., Hasebe F., Mathenge E.G., Igarashi A.J. Gen. Virol. 83:3075-3084(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: P123 is short-lived polyproteins, accumulating during early stage of infection. It localizes the viral replication complex to the cytoplasmic surface of modified endosomes and lysosomes. By interacting with nsP4, it starts viral genome replication into antigenome. After these early events, P123 is cleaved sequentially into nsP1, nsP2 and nsP3. This sequence of delayed processing would allow correct assembly and membrane association of the RNA polymerase complex (By similarity).

Involvement in disease:

Subcellular Location: Non-structural polyprotein: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Note=Located on the cytoplasmic surface of modified endosomes and lysosomes, also called cytopathic vacuoles type I (CPVI), These vacuoles contain numerous small circular invaginations (spherules) which may be the sites of RNA synthesis, SUBCELLULAR LOCATION: P123: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, SUBCELLULAR LOCATION: mRNA-capping enzyme nsP1: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host cell membrane, Peripheral membrane protein, Cytoplasmic side, Note=In the late phase of infection, the polyprotein is quickly cleaved before localization to cellular membranes, Then a fraction of nsP1 localizes to the inner surface of the plasma membrane and its filopodial extensions (By similarity), SUBCELLULAR LOCATION: Protease nsP2: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host nucleus, Note=In the late phase of infection, the polyprotein is quickly cleaved before localization to cellular membranes, Then approximately half of nsP2 is found in the nucleus (By similarity), SUBCELLULAR LOCATION: Non-structural protein 3: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host cytoplasm

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8JUX6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose