Recombinant Chicken Riboflavin-binding protein, partial | CSB-RP162294c(A4)

(No reviews yet) Write a Review
SKU:
CSB-RP162294c(A4)
Availability:
13 - 23 Working Days
  • Recombinant Chicken Riboflavin-binding protein, partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Chicken Riboflavin-binding protein, partial | CSB-RP162294c(A4) | Cusabio

Alternative Name(s): ; Riboflavin-binding protein; RBP) [Cleaved into: Riboflavin-binding protein; plasma form; Riboflavin-binding protein; yolk major form; Riboflavin-binding protein; yolk minor form]

Gene Names: N/A

Research Areas: Others

Organism: Gallus gallus (Chicken)

AA Sequence: QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 18-225aa

Sequence Info: Partial

MW: 27.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Required for the transport of riboflavin to the developing oocyte.

Reference: Chicken riboflavin-binding protein. cDNA sequence and homology with milk folate-binding protein.Zheng D.B., Lim H.M., Pene J.J., White H.B. IIIJ. Biol. Chem. 263:11126-11129(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Required for the transport of riboflavin to the developing oocyte.

Involvement in disease:

Subcellular Location:

Protein Families: Folate receptor family

Tissue Specificity: Yolk RBP is synthesized in the liver; egg-white RBP is synthesized in the oviduct.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02752

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose