null

Recombinant Chicken Homeobox protein engrailed-1 (EN1) | CSB-EP007659CH

(No reviews yet) Write a Review
SKU:
CSB-EP007659CH
Availability:
3 - 7 Working Days
  • Recombinant Chicken Homeobox protein engrailed-1 (EN1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €573.00
Frequently bought together:

Description

Recombinant Chicken Homeobox protein engrailed-1 (EN1) | CSB-EP007659CH | Cusabio

Alternative Name(s): Short name:Gg-En-1 Short name:Homeobox protein en-1

Gene Names: EN1

Research Areas: Neuroscience

Organism: Gallus gallus (Chicken)

AA Sequence: MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 1-333aa

Sequence Info: Full Length

MW: 48.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Cloning and sequence comparison of the mouse, human, and chicken engrailed genes reveal potential functional domains and regulatory regions."Logan C., Hanks M.C., Noble-Topham S., Nallainathan D., Provart N.J., Joyner A.L.Dev. Genet. 13:345-358(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: Engrailed homeobox family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q05916

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose