Recombinant Ceratopteris richardii Cyanovirin-N homolog | CSB-YP309974CGP

(No reviews yet) Write a Review
SKU:
CSB-YP309974CGP
Availability:
3 - 7 Working Days
  • Recombinant Ceratopteris richardii Cyanovirin-N homolog
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $2,427.60

Description

Recombinant Ceratopteris richardii Cyanovirin-N homolog | CSB-YP309974CGP | Cusabio

Alternative Name(s): Cyanovirin-N homolog; CV-N homolog

Gene Names: N/A

Research Areas: Others

Organism: Ceratopteris richardii (Triangle waterfern)

AA Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 28-142aa

Sequence Info: Full Length of Mature Protein

MW: 14.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Mannose-binding lectin

Reference: "The evolutionarily conserved family of cyanovirin-N homologs: structures and carbohydrate specificity."Koharudin L.M.I., Viscomi A.R., Jee J.-G., Ottonello S., Gronenborn A.M.Structure 16:570-584(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Mannose-binding lectin.

Involvement in disease:

Subcellular Location:

Protein Families: Cyanovirin-N family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P86326

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose