Recombinant Centruroides suffusus Beta-mammal toxin Css4, partial | CSB-EP350214DRC

Recombinant Centruroides suffusus Beta-mammal toxin Css4, partial | CSB-EP350214DRC | Cusabio

Alternative Name(s): ; Beta-mammal toxin Css4; Css IV; CssIV

Gene Names: N/A

Research Areas: Others

Organism: Centruroides suffusus suffusus (Mexican scorpion)

AA Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-85aa

Sequence Info: Partial

MW: 23.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Reference: Neutralization of gating charges in domain II of the sodium channel alpha subunit enhances voltage-sensor trapping by a beta-scorpion toxin.Cestele S., Scheuer T., Mantegazza M., Rochat H., Catterall W.A.J. Gen. Physiol. 118:291-302(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P60266

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A