Recombinant Carcinoscorpius rotundicauda Limulus clotting factor C, partial | CSB-YP638870CDQ

(No reviews yet) Write a Review
SKU:
CSB-YP638870CDQ
Availability:
25 - 35 Working Days
  • Recombinant Carcinoscorpius rotundicauda Limulus clotting factor C, partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00

Description

Recombinant Carcinoscorpius rotundicauda Limulus clotting factor C, partial | CSB-YP638870CDQ | Cusabio

Alternative Name(s): Limulus clotting factor C; FC; EC 3.4.21.84) [Cleaved into: Limulus clotting factor C heavy chain; Limulus clotting factor C light chain; Limulus clotting factor C chain A; Limulus clotting factor C chain B]

Gene Names: N/A

Research Areas: Others

Organism: Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda)

AA Sequence: SSQPSTVDLASKVKLPEGHYRVGSRAIYTCESRYYELLGSQGRRCDSNGNWSGRPASCIPVCGRSDSPRSPFIWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPNQFKMYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSETIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

Expression Region: 691-1019aa

Sequence Info: Partial

MW: 39.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of factor B.

Reference: "Molecular cloning and sequence analysis of factor C cDNA from the Singapore horseshoe crab, Carcinoscorpius rotundicauda." Ding J.L., Navas M.A. III, Ho B. Mol. Mar. Biol. Biotechnol. 4:90-103(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of factor B.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase S1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q26422

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose