Recombinant Bunyavirus La Crosse Nucleoprotein (N) | CSB-YP361397BNO

(No reviews yet) Write a Review
SKU:
CSB-YP361397BNO
Availability:
3 - 7 Working Days
  • Recombinant Bunyavirus La Crosse Nucleoprotein (N)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00

Description

Recombinant Bunyavirus La Crosse Nucleoprotein (N) | CSB-YP361397BNO | Cusabio

Alternative Name(s): Nucleocapsid protein

Gene Names: N

Research Areas: Microbiology

Organism: Bunyavirus La Crosse

AA Sequence: MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-235aa

Sequence Info: Full Length

MW: 28.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation

Reference: "Structural basis for encapsidation of genomic RNA by La Crosse Orthobunyavirus nucleoprotein." Reguera J., Malet H., Weber F., Cusack S. Proc. Natl. Acad. Sci. U.S.A. 110:7246-7251(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation (By similarity).

Involvement in disease:

Subcellular Location: Virion

Protein Families: Orthobunyavirus nucleocapsid protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04873

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose