Recombinant Brugia malayi tRNA (guanine-N (7) -) -methyltransferase (Bm1_01445) | CSB-EP427056BWV

Recombinant Brugia malayi tRNA (guanine-N (7) -) -methyltransferase (Bm1_01445) | CSB-EP427056BWV | Cusabio

Alternative Name(s): tRNA (guanine(46)-N(7))-methyltransferase tRNA(m7G46)-methyltransferase

Gene Names: Bm1_01445

Research Areas: Others

Organism: Brugia malayi (Filarial nematode worm)

AA Sequence: MVSTENKIGLFKNKDDDIDGEEMRELPQKKFYRQRAHANPISDHEFDYPVFPEQMDWKKYFGDFSEGRQVEFADVGCGYGGLLIKLSTLYPEALMVGLEIRVKVSDYVQDKIHALRLREPGNYRNVACLRTNAMKYLPNYFRRHQLTKMFFLYPDPHFKKAKHKWRIITPTLLAEYAYVLKPGGLVYTITDVEELHIWMVRHLSAHPLFERLTDLEMKMDPVVEMLYDSTEEGQKVARNEGSKWSAVFRRLPNPVLSS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-258aa

Sequence Info: Full Length

MW: 36.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Catalyzes the formation of N7-methylguanine at position 46 (m7G46) in tRNA.

Reference: "Draft genome of the filarial nematode parasite Brugia malayi." Ghedin E., Wang S., Spiro D., Caler E., Zhao Q., Crabtree J., Allen J.E., Delcher A.L., Guiliano D.B., Miranda-Saavedra D., Angiuoli S.V., Creasy T., Amedeo P., Haas B., El-Sayed N.M., Wortman J.R., Feldblyum T., Tallon L. Scott A.L. Science 317:1756-1760(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A8NFF0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A