Recombinant Bovine viral diarrhea virus Genome polyprotein, partial | CSB-EP312464BKX1

Recombinant Bovine viral diarrhea virus Genome polyprotein, partial | CSB-EP312464BKX1 | Cusabio

Alternative Name(s): Genome polyprotein [Cleaved into: N-terminal protease; N-pro; EC 3.4.22.-; Autoprotease p20); Capsid protein C; E(rns) glycoprotein; gp44/48); Envelope glycoprotein E1; gp33); Envelope glycoprotein E2; gp55); p7; Non-structural protein 2-3; Cysteine protease NS2; EC 3.4.22.-; Non-structural protein 2); Serine protease NS3; EC 3.4.21.113; EC 3.6.1.15; EC 3.6.4.13; Non-structural protein 3); Non-structural protein 4A; NS4A); Non-structural protein 4B; NS4B); Non-structural protein 5A; NS5A); RNA-directed RNA polymerase; EC 2.7.7.48; NS5B)]

Gene Names: N/A

Research Areas: Others

Organism: Bovine viral diarrhea virus (strain SD-1) (BVDV) (Mucosal disease virus)

AA Sequence: MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-168aa

Sequence Info: Partial

MW: 25.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Initial binding to target cell probably involves interaction of E with glycosaminoglycans. E1 and/or E2 are responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.P7 forms a leader sequence to properly orient NS2 in the membrane.Uncleaved NS2-3 is required for production of infectious virus.NS2 protease seems to play a vital role in viral RNA replication control and in the pathogenicity of the virus.NS3 displays three enzymatic activities: serine protease, NTPase and RNA helicase.NS4A is a cofactor for the NS3 protease activity.RNA-directed RNA polymerase NS5 replicates the viral (+) and (-) genome.

Reference: "Structure of a pestivirus envelope glycoprotein E2 clarifies its role in cell entry." El Omari K., Iourin O., Harlos K., Grimes J.M., Stuart D.I. Cell Rep 3:30-35(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q01499

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A