Recombinant Bovine Ubiquitin-like protein ISG15 (ISG15) | CSB-EP011843BO

(No reviews yet) Write a Review
SKU:
CSB-EP011843BO
Availability:
3 - 7 Working Days
£281.60 - £1,361.60

Description

Recombinant Bovine Ubiquitin-like protein ISG15 (ISG15) | CSB-EP011843BO | Cusabio

Alternative Name(s): Interferon-stimulated gene product 17 (Ubiquitin cross-reactive protein) (BoUCRP) (G1P2) (ISG17) (UCRP)

Gene Names: ISG15

Research Areas: Cell Biology

Organism: Bos taurus (Bovine)

AA Sequence: MGGDLTVKMLGGQEILVPLRDSMTVSELKQFIAQKINVPAFQQRLAHLDSREVLQEGVPLVLQGLRAGSTVLLVVQNCISILVRNDKGRSSPYEVQLKQTVAELKQQVCQKERVQADQFWLSFEGRPMDDEHPLEEYGLMKGCTVFMNLRLRGG

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-154aa

Sequence Info: Full Length

MW: 21.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Exhibits antiviral activity towards both DNA and RNA viruses. The secreted form of ISG15 can: induce natural killer cell proliferation, augment lymphokine-activated-killer activity, induce dendritic cell maturation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha, and thus prevent lysis of the corpus luteum and maintain the pregnancy.

Reference: "Complementary deoxyribonucleic acid sequence encoding bovine ubiquitin cross-reactive protein: a comparison with ubiquitin and a 15-kDa ubiquitin homolog." Austin K.J., Pru J.K., Hansen T.R. Endocrine 5:191-197(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O02741

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose