Recombinant Bovine Rhodopsin (RHO), partial | CSB-EP019681BO1

Recombinant Bovine Rhodopsin (RHO), partial | CSB-EP019681BO1 | Cusabio

Alternative Name(s): RHO; Rhodopsin

Gene Names: RHO

Research Areas: Signal Transduction

Organism: Bos taurus (Bovine)

AA Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQ

Source: E.coli

Tag Info: N-terminal 6xHis-KSI-tagged

Expression Region: 1-36aa

Sequence Info: Partial

MW: 19.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth (By similarity). Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins.

Reference: "Rhodopsin and bacteriorhodopsin: structure-function relationships." Ovchinnikov Y.A. FEBS Lett. 148:179-191(1982)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02699

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A