Recombinant Bovine Pregnancy-associated glycoprotein 2 (PAG2) | CSB-EP637747BO

(No reviews yet) Write a Review
SKU:
CSB-EP637747BO
Availability:
3 - 7 Working Days
  • Recombinant Bovine Pregnancy-associated glycoprotein 2 (PAG2)
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP637747BO could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) PAG2.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP637747BO could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) PAG2.
€352.00 - €1,702.00

Description

Recombinant Bovine Pregnancy-associated glycoprotein 2 (PAG2) | CSB-EP637747BO | Cusabio

Alternative Name(s): PAG 2

Gene Names: PAG2

Research Areas: Signal Transduction

Organism: Bos taurus (Bovine)

AA Sequence: KKMKTLRETLREKNLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPITIFYGSGIIQGFLGSDTVRIGNLVSPEQSFGLSLEEYGFDSLPFDGILGLAFPAMGIEDTIPIFDNLWSHGAFSEPVFAFYLNTNKPEGSVVMFGGVDHRYYKGELNWIPVSQTSHWQISMNNISMNGTVTACSCGCEALLDTGTSMIYGPTKLVTNIHKLMNARLENSEYVVSCDAVKTLPPVIFNINGIDYPLRPQAYIIKIQNSCRSVFQGGTENSSLNTWILGDIFLRQYFSVFDRKNRRIGLAPAV

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-376aa

Sequence Info: Full Length of Mature Protein

MW: 43.6

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: PAG2 or a processed derivative of this molecule might represent a factor that binds the LH receptor.

Reference: "The glycosylation of pregnancy-associated glycoproteins and prolactin-related protein-I in bovine binucleate trophoblast giant cells changes before parturition." Klisch K., Boos A., Friedrich M., Herzog K., Feldmann M., Sousa N., Beckers J., Leiser R., Schuler G. Reproduction 132:791-798(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q28057

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose