Recombinant Bovine Myotrophin (MTPN) | CSB-YP015195BOb0

(No reviews yet) Write a Review
SKU:
CSB-YP015195BOb0
Availability:
3 - 7 Working Days
$459.60 - $2,427.60

Description

Recombinant Bovine Myotrophin (MTPN) | CSB-YP015195BOb0 | Cusabio

Alternative Name(s): MTPN; Myotrophin

Gene Names: MTPN

Research Areas: Cardiovascular

Organism: Bos taurus (Bovine)

AA Sequence: CDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

Expression Region: 2-118aa

Sequence Info: Full Length of Mature Protein

MW: 15.2

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Promotes dimerization of NF-kappa-B subunits and regulates NF-kappa-B transcription factor activity. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy. Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex formed by the CAPZA1 and CAPZB heterodimer

Reference: "Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells." Kitazawa M., Yamakuni T., Song S.Y., Kato C., Tsuchiya R., Ishida M., Suzuki N., Adachi E., Iwashita S., Ueno S., Yanagihara N., Taoka M., Isobe T., Ohizumi Y. Biochem. Biophys. Res. Commun. 331:181-186(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q3T0F7

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose