Recombinant Bovine Lutropin subunit beta (LHB) | CSB-EP012910BO

(No reviews yet) Write a Review
SKU:
CSB-EP012910BO
Availability:
3 - 7 Working Days
  • Recombinant Bovine Lutropin subunit beta (LHB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Bovine Lutropin subunit beta (LHB) | CSB-EP012910BO | Cusabio

Alternative Name(s): Luteinizing hormone subunit beta ;LH-B ;LSH-B ;LSH-beta;Lutropin beta chain

Gene Names: LHB

Research Areas: Others

Organism: Bos taurus (Bovine)

AA Sequence: SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-141aa

Sequence Info: Full Length of Mature Protein

MW: 17 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.

Reference: The gene for the beta subunit of bovine luteinizing hormone encodes a gonadotropin mRNA with an unusually short 5'-untranslated region.Virgin J.B., Silver B.J., Thomason A.R., Nilson J.H.J. Biol. Chem. 260:7072-7077(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Glycoprotein hormones subunit beta family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04651

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose