Recombinant Bovine Interferon omega-1 (IFNW1) | CSB-EP011061BO

Recombinant Bovine Interferon omega-1 (IFNW1) | CSB-EP011061BO | Cusabio

Alternative Name(s): IFN-omega-c1 Interferon alpha-II-1

Gene Names: IFNW1

Research Areas: Immunology

Organism: Bos taurus (Bovine)

AA Sequence: CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-195aa

Sequence Info: Full Length of Mature Protein

MW: 35.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Two distinct families of human and bovine interferon-alpha genes are coordinately expressed and encode functional polypeptides." Capon D.J., Shepard H.M., Goeddel D.V. Mol. Cell. Biol. 5:768-779(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Alpha/beta interferon family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07352

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A