Recombinant Bovine Interferon alpha-G (IFNAG) | CSB-EP344226BO

Recombinant Bovine Interferon alpha-G (IFNAG) | CSB-EP344226BO | Cusabio

Alternative Name(s): IFN-alpha7

Gene Names: IFNAG

Research Areas: Immunology

Organism: Bos taurus (Bovine)

AA Sequence: CHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQFFSVEGSAVVWDESLLDKLRDALDQQLTDLQFCLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQERFRRKD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-189aa

Sequence Info: Full Length of Mature Protein

MW: 35.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Reference: "The cloning of cattle interferon-A subtypes isolated from the gut epithelium of rotavirus-infected calves."Chaplin P.J., Parsons K.R., Collins B.A.Immunogenetics 44:143-145(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Alpha/beta interferon family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49877

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A