Cusabio Covid-19 Recombinants
Recombinant Bovine coronavirus Nucleoprotein (N) | CSB-EP886131BJJ
- SKU:
- CSB-EP886131BJJ
- Availability:
- 13 - 23 Working Days
Description
Recombinant Bovine coronavirus Nucleoprotein (N) | CSB-EP886131BJJ | Cusabio
Target Name: N
Uniprot No: Q9QAR8
Species: Bovine coronavirus (strain LY-138) (BCoV) (BCV)
Source: E.coli
Tag Info: C-terminal 6xHis-tagged
Expression Region: 1-448aa
Sequence Description: Full Length
Target Protein Sequence: MSFTPGKQSSSRASSGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRADSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
Mol. Weight: 50.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test.
Biological Activity: N/A
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.