Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) | CSB-YP314697BJF

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) | CSB-YP314697BJF | Cusabio

Target Name: 4b

Uniprot No: P0C2R2

Species: Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV)

Source: Yeast

Tag Info: C-terminal 6xHis-tagged

Expression Region: 1-45aa

Sequence Description: Full Length

Target Protein Sequence: MPMATTIEGADYTNIMPITVLTTVYLGVSIGIDTSTTGFTCFSRY

Mol. Weight: 6.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.